PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 787aa    MW: 88381.7 Da    PI: 9.4916
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088850.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3681.3e-2170161599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      + +  ++++rl+lp +f++e+g++k++  ++ l  ++g +W  +l  ++++gr++l++GWk+FvkangLk+g++v+++l + +++ +v++++++
  Csa09g088850.1  70 RLAPVDGRHCRLRLPMQFTRENGINKPG--KIYLLGKDGSKWLANLLLENTRGRMTLGDGWKSFVKANGLKTGESVTLRLCW-EDTIPVLSLCSE 161
                     55667889***************99776..8*************************************************99.777789888875 PP

2B368.49.8e-22220310498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++++d+lk+grl+lp +f++e++++k++  ++tl  ++g +W v l    k+gr+ l+kGWk+F+kangL++ D+++++l++ +++++ ++++r
  Csa09g088850.1 220 LTITPDSLKHGRLRLPLQFMAENNMDKPG--EITLLGKDGAKWLVSLL-LEKRGRMSLGKGWKDFAKANGLRTDDSITLELIW-ENATPILHLLR 310
                     6789*******************999766..8***************5.66667889**************************.77778887766 PP

3B369.25.7e-22550633187
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     f++ ++++d+l++grl+lp +f++e++++k++  ++tl  ++g +W v l    ++gr+ l+kGWk+F+k+ngLk+gD+++F+ +g+
  Csa09g088850.1 550 FLTLTITPDSLRHGRLRLPLEFMTENNMNKPG--EITLLGKNGAKWLVSLL-LERRGRMSLGKGWKNFAKENGLKTGDSITFESIGQ 633
                     778899********************999766..8***************5.55556789***********************7764 PP

4B347.53.2e-15694780393
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     + ++++   + g l lp kf++ +g++k++  ++tl  + g +W  +l    ++g++vl++GWk+F++ang+  g++++++++ +++++ v
  Csa09g088850.1 694 TLTLTPEDVRDGTLHLPSKFMRINGINKPG--QITLLGRGGMKWFAYL--LPRDGTVVLGNGWKGFCEANGVMLGESFILEFIPKEDTNHV 780
                     5555666666778********999999877..6***************..*******************************9866666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.0E-2161160IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-2262160IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.87566162IPR003340B3 DNA binding domain
SMARTSM010192.7E-2966162IPR003340B3 DNA binding domain
PfamPF023629.2E-2166161IPR003340B3 DNA binding domain
CDDcd100176.00E-1976160No hitNo description
Gene3DG3DSA:2.40.330.102.0E-21209310IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.8E-22212308IPR015300DNA-binding pseudobarrel domain
CDDcd100171.05E-19216310No hitNo description
PROSITE profilePS5086315.312217312IPR003340B3 DNA binding domain
SMARTSM010193.8E-30217312IPR003340B3 DNA binding domain
PfamPF023627.8E-21219310IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-23546641IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.4E-22546641IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086316.497550645IPR003340B3 DNA binding domain
SMARTSM010192.4E-27550645IPR003340B3 DNA binding domain
CDDcd100175.66E-19550642No hitNo description
PfamPF023621.0E-20550633IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.5E-19684781IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-21686782IPR015300DNA-binding pseudobarrel domain
CDDcd100172.68E-14691785No hitNo description
PROSITE profilePS5086313.733692786IPR003340B3 DNA binding domain
SMARTSM010192.0E-19692785IPR003340B3 DNA binding domain
PfamPF023622.1E-14692782IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
FQRKKKVKQS NTETEPDYSC FNAHVTASSQ QSGRLYLPQD FTSSNGLIRK CSKSPPQIVS  60
SSDKHFITFR LAPVDGRHCR LRLPMQFTRE NGINKPGKIY LLGKDGSKWL ANLLLENTRG  120
RMTLGDGWKS FVKANGLKTG ESVTLRLCWE DTIPVLSLCS EEYITDTRVG GVGCSEASEK  180
VPLPTEPETN KDESSSWKRE NNHMRCIDST SSSQNHILTL TITPDSLKHG RLRLPLQFMA  240
ENNMDKPGEI TLLGKDGAKW LVSLLLEKRG RMSLGKGWKD FAKANGLRTD DSITLELIWE  300
NATPILHLLR IESSSGRGQS DFSKEYLSIE PSSGNKARKS DNNREESKKH PPRSRESSSA  360
IQNQFMALTR PSGIINQGAL HLQTNEVFIY RNEGGNMLQI SDLGPYFFGI RDVPAPSSNN  420
DHDRIGNISM KMHPHLRKEA GFSSYDGDDH DNFEGPSKKR VRKNNPETEE NYSSDHSRFG  480
AHVTTTSNLH TNELRLAAKE SLPIGPSVEK KISEGENSKD KNNMVESSSC GREENHLRCI  540
ASISPRQNRF LTLTITPDSL RHGRLRLPLE FMTENNMNKP GEITLLGKNG AKWLVSLLLE  600
RRGRMSLGKG WKNFAKENGL KTGDSITFES IGQNASHVLS LLYIESSTVR GQSDFPKESH  660
FTNREERNSR ELEKRTYCPR IQNSSSDIQN RFVTLTLTPE DVRDGTLHLP SKFMRINGIN  720
KPGQITLLGR GGMKWFAYLL PRDGTVVLGN GWKGFCEANG VMLGESFILE FIPKEDTNHV  780
FNFYSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431598.10.0PREDICTED: B3 domain-containing protein REM-like 1
SwissprotQ8S8E80.0REML1_ARATH; B3 domain-containing protein REM-like 1
TrEMBLR0FUN00.0R0FUN0_9BRAS; Uncharacterized protein (Fragment)
STRINGAT2G24690.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150791619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24690.10.0B3 family protein